Other
Teriparatide
Also called Forteo, PTH(1-34)
per administration
A human trial worked out how much to take and how often, so a dosing schedule is shown.
Licensed as a medicine in the US and EU.
Quick start
Teriparatide at a glance — the figures, plus how it's commonly run. Reference only, not medical advice.
- Typical dose
- 20–40 mcg per administration
- How often
- Every day
- Where
- Subcutaneous — abdomen, thigh, or upper arm Sites and rotation
- Time to steady level
- ~5 hours — about five half-lives
- Storage
- Dry vial kept cold and dark; a mixed vial in the fridge at 2–8 °C. Details
A research and community reference, not medical advice. Figures are descriptive, vary between sources, and are not a recommendation for use.
Key properties
Molecular reference data.
- Formula
- C181H291N55O51S2
- Mol. weight
- 4,117.8 Da
- CAS
- 52232-67-4
- PubChem CID
- 16133850
Sequence (one-letter)
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
External references
Work out your draw
These numbers are a starting point — change any of them.
Vial label
Copy this into your label printer.
Published research contexts for Teriparatide describe 20–40 mcg per administration. Descriptive only, not a recommendation.
About an hour after a subcutaneous dose; the intravenous half-life is only a few minutes, so absorption sets the apparent rate.
A recombinant N-terminal fragment of parathyroid hormone, PTH(1–34), licensed as a medicine in the US and EU. typicalVialSizesMg here is the pre-filled multi-dose pen (0.62 mg ≈ 620 mcg), not a lyophilised vial: the pen holds a ready solution and delivers 20 mcg per day for about 28 days, so there is nothing to reconstitute. The pivotal study (Neer, NEJM 2001) compared 20 and 40 mcg given subcutaneously once daily.
Dosing schedule
How Teriparatide is commonly stepped up, for reference only.
These are commonly-discussed research protocols shared for educational reference. This is not medical advice and is not a substitute for guidance from a qualified professional.
| Phase | Amount | Frequency | Route |
|---|---|---|---|
| StandardThe amount carried into licensing from the pivotal study. | 20 mcg | Once daily | SubQ |
| Also studiedThe higher arm of the same study; the 20 mcg amount became the standard one. | 40 mcg | Once daily | SubQ |
Modelled level — every day
1× is the peak after a single dose.
- Steady-state peak
- 1.00× single dose
- Time to steady state
- 5hours
- Administrations
- 7/ week
Read off the modelled curve, not an even-interval formula
About five half-lives
Where these numbers come from
- Neer RM et al., NEJM 2001;344:1434Daily subcutaneous 20 and 40 mcg versus placebo over about 19 months, with bone-density and fracture endpoints in postmenopausal osteoporosis research.