Skip to content
PeptideWiki.bio

Other

Teriparatide

Also called Forteo, PTH(1-34)

InjectableEvidence AEvery day
Half-life
1hours
Typical vial
0.62mg
Research amounts
20–40mcg

per administration

Common schedule
Every day
Tested in people

A human trial worked out how much to take and how often, so a dosing schedule is shown.

Licensed as a medicine in the US and EU.

Quick start

Teriparatide at a glance — the figures, plus how it's commonly run. Reference only, not medical advice.

Typical dose
20–40 mcg per administration
How often
Every day
Where
Subcutaneous — abdomen, thigh, or upper arm Sites and rotation
Time to steady level
~5 hours — about five half-lives
Storage
Dry vial kept cold and dark; a mixed vial in the fridge at 2–8 °C. Details

A research and community reference, not medical advice. Figures are descriptive, vary between sources, and are not a recommendation for use.

Key properties

Molecular reference data.

Formula
C181H291N55O51S2
Mol. weight
4,117.8 Da
CAS
52232-67-4
PubChem CID
16133850

Sequence (one-letter)

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Work out your draw

These numbers are a starting point — change any of them.

Vial label

Copy this into your label printer.

Published research contexts for Teriparatide describe 2040 mcg per administration. Descriptive only, not a recommendation.

About an hour after a subcutaneous dose; the intravenous half-life is only a few minutes, so absorption sets the apparent rate.

A recombinant N-terminal fragment of parathyroid hormone, PTH(1–34), licensed as a medicine in the US and EU. typicalVialSizesMg here is the pre-filled multi-dose pen (0.62 mg ≈ 620 mcg), not a lyophilised vial: the pen holds a ready solution and delivers 20 mcg per day for about 28 days, so there is nothing to reconstitute. The pivotal study (Neer, NEJM 2001) compared 20 and 40 mcg given subcutaneously once daily.

Dosing schedule

How Teriparatide is commonly stepped up, for reference only.

These are commonly-discussed research protocols shared for educational reference. This is not medical advice and is not a substitute for guidance from a qualified professional.

PhaseAmountFrequencyRoute
StandardThe amount carried into licensing from the pivotal study.20 mcgOnce dailySubQ
Also studiedThe higher arm of the same study; the 20 mcg amount became the standard one.40 mcgOnce dailySubQ

Modelled level — every day

1× is the peak after a single dose.

Steady-state peak
1.00× single dose

Read off the modelled curve, not an even-interval formula

Time to steady state
5hours

About five half-lives

Administrations
7/ week

Where these numbers come from

  • Neer RM et al., NEJM 2001;344:1434Daily subcutaneous 20 and 40 mcg versus placebo over about 19 months, with bone-density and fracture endpoints in postmenopausal osteoporosis research.

Next steps